PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN08689.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bHLH
Protein Properties Length: 93aa    MW: 10356.7 Da    PI: 9.3337
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN08689.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH28.13.7e-0921601554
                HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
         HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                +i +  ++L++l+P++ + +s K+s a +L+++++YIk+L
  KHN08689.1 21 QITDLVSKLQQLIPELRARRSDKVSAAKVLQETCNYIKNL 60
                6889999********879********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.801660IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.9E-92176IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.5E-62160IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.07E-92182IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MSSRRSRSRQ SGASAEITDA QITDLVSKLQ QLIPELRARR SDKVSAAKVL QETCNYIKNL  60
HREVDDLSDR LSELLANTDS NSAQAAIIRS LLM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1417171e-104BT141717.1 Lotus japonicus clone JCVI-FLLj-9B13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003519021.18e-60PREDICTED: transcription factor PRE6
RefseqXP_014507695.18e-60PREDICTED: transcription factor PRE6
SwissprotQ8GW327e-41PRE6_ARATH; Transcription factor PRE6
TrEMBLA0A0B2PLW09e-60A0A0B2PLW0_GLYSO; Transcription factor bHLH135
TrEMBLA0A0R4J2M09e-60A0A0R4J2M0_SOYBN; Uncharacterized protein
STRINGGLYMA02G02250.12e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF56734143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.13e-42bHLH family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]